Proteintech, 31914-1-AP, FAM222A Polyclonal antibody

Size: 20ul / 150ul The FAM222A (31914-1-AP) by Proteintech is a Polyclonal antibody targeting FAM222A in WB, ELISA applications with reactivity to human samples 31914-1-AP targets FAM222A in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: COLO 320 cells, HepG2 cells, HuH-7 cells, MDA-MB-453 cells, SH-SY5Y cells, TT cells, U2OS cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information Family with sequence similarity 222 member A (FAM222A, also known as C12orf34) is associated with the progress of Alzheimer's disease (PMID: 31964863; 37092222). It is also a novel key determinant of endothelial biology and angiogenesis (PMID: 37942611). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36045 Product name: Recombinant human C12orf34 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 191-325 aa of BC037221 Sequence: LPPSNLPSIHSLLYQLNQQCQAPGAAPPACQGMAIPHPSPAKHGPVPSFPSMAYSAAAGLPDCRKGTELGQGATQALTLAGAAKPAGYADSGLDYLLWPQKPPPPPPQPLRAYSGSTVASKSPEACGGRAYERAS Predict reactive species Full Name: chromosome 12 open reading frame 34 Calculated Molecular Weight: 47 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC037221 Gene Symbol: C12orf34 Gene ID (NCBI): 84915 RRID: AB_3670141 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q5U5X8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.