Proteintech, 31917-1-AP, TMEM143 Polyclonal antibody

Size: 20ul / 150ul The TMEM143 (31917-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM143 in WB, IHC, ELISA applications with reactivity to human samples 31917-1-AP targets TMEM143 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HH cells, HepG2 cells, Jurkat cells, Ramos cells Positive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Transmembrane protein 143 (TMEM143) is a transmembrane protein and a member of the TMEM (Transmembrane) protein family, which is located in mitochondria (PMID: 11256614). It is known that members of the TMEM family play an important role in the development and metastasis of cancer, especially in conveying information between the extracellular environment and cytoplasmic proteins (PMID: 31454669). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36277 Product name: Recombinant human TMEM143 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 51-200 aa of BC016919 Sequence: MGEYRKMWNPREPRDWAQQYRERFIPFSKEQLLRLLIQEFHSSPAEKAALEAFSAHVDFCTLFHYHQILARLQALYDPINPDRETLDQPSLTDPQRLSNEQEVLRALEPLLAQANFSPLSEDTLAYALVVHHPQDEVQVTVNLDQYVYIH Predict reactive species Full Name: transmembrane protein 143 Calculated Molecular Weight: 52 kDa Observed Molecular Weight: 45-52 kDa GenBank Accession Number: BC016919 Gene Symbol: TMEM143 Gene ID (NCBI): 55260 RRID: AB_3670142 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q96AN5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.