Proteintech, 31947-1-AP, CD2 Polyclonal antibody

Size: 20ul / 150ul The CD2 (31947-1-AP) by Proteintech is a Polyclonal antibody targeting CD2 in WB, IF/ICC, ELISA applications with reactivity to mouse, rat samples 31947-1-AP targets CD2 in WB, IF/ICC, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: CTLL-2 cells, mouse spleen tissue, mouse thymus tissue, rat spleen tissue, rat thymus tissue Positive IF/ICC detected in: EL-4 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information CD2 is a cell surface glycoprotein present on a majority of thymocytes, all mature T cells and subset of NK cells but not on B lymphocytes. It is a pan T-cell marker. CD2 interacts with lymphocyte function-associated antigen (LFA-3/CD58) and CD48/BCM1 to mediate adhesion between T-cells and other cell types. CD2 is implicated in the triggering of T-cells, the cytoplasmic domain is implicated in the signaling function. Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg1403 Product name: Recombinant Mouse CD2 protein (rFc Tag) (HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 23-203 aa of NM_013486.2 Sequence: RDNETIWGVLGHGITLNIPNFQMTDDIDEVRWVRRGTLVAEFKRKKPPFLISETYEVLANGSLKIKKPMMRNDSGTYNVMVYGTNGMTRLEKDLDVRILERVSKPMIHWECPNTTLTCAVLQGTDFELKLYQGETLLNSLPQKNMSYQWTNLNAPFKCEAINPVSKESKMEVVNCPEKGLS Predict reactive species Full Name: CD2 antigen Calculated Molecular Weight: 38 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: NM_013486.2 Gene Symbol: CD2 Gene ID (NCBI): 12481 RRID: AB_3670154 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P08920 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.