Iright
BRAND / VENDOR: Proteintech

Proteintech, 31988-1-AP, MEIS1 Polyclonal antibody

CATALOG NUMBER: 31988-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MEIS1 (31988-1-AP) by Proteintech is a Polyclonal antibody targeting MEIS1 in WB, ELISA applications with reactivity to human samples 31988-1-AP targets MEIS1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293T cells, IMR-32 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information MEIS1 encodes a TALE homeodomain transcription factor (TF). MEIS1 controls various non-neural developmental processe. In addition, MEIS1 regulates neural development in striatum, midbrain, cerebellum, retina and sympathetic neurons as well adult neurogenesis in the olfactory bulb and are also expressed in neural stem cells (PMID: 39578497). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag33675 Product name: Recombinant human MEIS1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-390 aa of BC043503 Sequence: MAQRYDDLPHYGGMDGVGIPSTMYGDPHAARSMQPVHHLNHGPPLHSHQYPHTAHTNAMAPSMGSSVNDALKRDKDAIYGHPLFPLLALIFEKCELATCTPREPGVAGGDVCSSESFNEDIAVFAKQIRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDDREGGSKSDSEDITRSANLTDQPSWNRDHDDTASTRSGGTPGPSSGGHTSHSGDNSSEQGDGLDNSVASPSTGDDDDPDKDKKRHKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGTPYNPDGQPMGGFVMDGQQHMGIRAPGPMSGMGMNMGMEGQWHYM* Predict reactive species Full Name: Meis homeobox 1 Calculated Molecular Weight: 43, 50 kDa Observed Molecular Weight: 44 kDa, 53 kDa GenBank Accession Number: BC043503 Gene Symbol: MEIS1 Gene ID (NCBI): 4211 RRID: AB_3670166 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: O00470 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924