Proteintech, 32030-1-AP, TCF20 Polyclonal antibody

Size: 20ul / 150ul The TCF20 (32030-1-AP) by Proteintech is a Polyclonal antibody targeting TCF20 in WB, ELISA applications with reactivity to human samples 32030-1-AP targets TCF20 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: SH-SY5Y cells, U-251 cells, U2OS cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Transcription Factor 20 (TCF20) is a transcriptional activator that binds to the regulatory region of MMP3 and thereby controls stromelysin expression. It stimulates the activity of various transcriptional activators such as JUN, SP1, PAX6 and ETS1, suggesting a function as a coactivator (PMID: 10995766). The calculated molecular weight of TCF20 is 211 kDa, but due to extensive modifications (Glycosylation, Sumoylation. Phosphorylation), the observed molecular weight is about 250 kda. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36912 Product name: Recombinant human TCF20 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 480-650 aa of NM_005650 Sequence: TPQKKTSKRPSSSKKADSCTNSEGSSQPEEQLKSPMAESLDGGCSSSSEDQGERVRQLSGQSTSSDTTYKGGASEKAGSSPAQGAQNEPPRLNASPAAREEATSPGAKDMPLSSDGNPKVNEKTVGVIVSREAMTGRVEKPGGQDKGSQEDDPAATQRPPSNGGAKETSHA Predict reactive species Full Name: transcription factor 20 (AR1) Calculated Molecular Weight: 1960aa, 212 kDa Observed Molecular Weight: 250 kDa GenBank Accession Number: NM_005650 Gene Symbol: TCF20 Gene ID (NCBI): 6942 RRID: AB_3670174 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9UGU0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.