Iright
BRAND / VENDOR: Proteintech

Proteintech, 32080-1-AP, CCDC47 Polyclonal antibody

CATALOG NUMBER: 32080-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CCDC47 (32080-1-AP) by Proteintech is a Polyclonal antibody targeting CCDC47 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 32080-1-AP targets CCDC47 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Jurkat cells, L02 cells, RT-4 cells, mouse heart tissue, mouse lung tissue, rat heart tissue Positive IHC detected in: mouse cerebellum tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information Coiled-coil domain containing 47 (CCDC47, also known as THNS, GK001, and MSTP041) is an endoplasmic reticulum (ER) transmembrane protein involved in calcium signaling through utilization of its calcium binding-acidic luminal domain. It also interacts with the ERAD (endoplasmic reticulum-associated degradation) complex and is involved in ER stress relief (PMID: 28974366). The expression level of CCDC47 is associated with diabetic cardiomyopathy (PMID: 30140426). Its variant would cause trichohepatoneurodevelopmental syndrome (PMID: 38524542). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36570 Product name: Recombinant human CCDC47 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 156-483 aa of BC008905 Sequence: GKNKNSRLAQAWFNTHRELLESNFTLVGDDGTNKEATSTGKLNQENEHIYNLWCSGRVCCEGMLIQLRFLKRQDLLNVLARMMRPVSDQVQIKVTMNDEDMDTYVFAVGTRKALVRLQKEMQDLSEFCSDKPKSGAKYGLPDSLAILSEMGEVTDGMMDTKMVHFLTHYADKIESVHFSDQFSGPKIMQEEGQPLKLPDTKRTLLFTFNVPGSGNTYPKDMEALLPLMNMVIYSIDKAKKFRLNREGKQKADKNRARVEENFLKLTHVQRQEAAQSRREEKKRAEKERIMNEEDPEKQRRLEEAALRREQKKLEKKQMKMKQIKVKAM Predict reactive species Full Name: coiled-coil domain containing 47 Calculated Molecular Weight: 56 kDa Observed Molecular Weight: 56 kDa GenBank Accession Number: BC008905 Gene Symbol: CCDC47 Gene ID (NCBI): 57003 RRID: AB_3670185 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q96A33 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924