Iright
BRAND / VENDOR: Proteintech

Proteintech, 32088-1-AP, PIANP Polyclonal antibody

CATALOG NUMBER: 32088-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PIANP (32088-1-AP) by Proteintech is a Polyclonal antibody targeting PIANP in WB, ELISA applications with reactivity to human samples 32088-1-AP targets PIANP in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A375 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information Pianp (also known as Leda-1) is a type I transmembrane protein with preferential expression in the mammalian CNS. Its processing is characterized by proteolytic cleavage by a range of proteases including Adam10, Adam17, MMPs, and the γ-secretase complex. Pianp can interact with Pilrα and the GB1a subunit of the GABAB receptor (GBR) complex. Pianp represents a novel candidate gene involved in autism-like behavior, cerebellar and hippocampal pathology, and GBR signaling (PMID: 31511635). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35273 Product name: Recombinant human C12orf53 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 32-178 aa of BC035736 Sequence: SSSSPRTPPAPARPPCARGGPSAPRHVCVWERAPPPSRSPRVPRSRRQVLPGTAPPATPSGFEEGPPSSQYPWAIVWGPTVSREDGGDPNSANPGFLDYGFAAPHGLATPHPNSDSMRGDGDGLILGEAPATLRPFLFGGRGEGVDP Predict reactive species Full Name: chromosome 12 open reading frame 53 Observed Molecular Weight: 30 kDa GenBank Accession Number: BC035736 Gene Symbol: C12orf53 Gene ID (NCBI): 196500 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q8IYJ0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924