Iright
BRAND / VENDOR: Proteintech

Proteintech, 32117-1-AP, SBK2 Polyclonal antibody

CATALOG NUMBER: 32117-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SBK2 (32117-1-AP) by Proteintech is a Polyclonal antibody targeting SBK2 in WB, IF/ICC, ELISA applications with reactivity to human samples 32117-1-AP targets SBK2 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, HepG2 cells, Kasumi-1 cells Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information SH3 domain binding kinase family member 2 (SBK2, also known as SGK069), is an evolutionarily conserved putative serine/threonine protein kinase that plays a crucial role in cardiomyocyte differentiation, particularly in the formation and maintenance of sarcomeres. It is highly atrium-enriched and is muscle-specific, indicating its specialized function in cardiac muscle cells (PMID: 35587025). SBK2 may be useful for identifying and co-registering tumor borders during surgical resection (PMID: 23730413). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag37233 Product name: Recombinant human SBK2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 185-348 aa of NM_001101401 Sequence: KPENVLVCDPACRRFKLTDFGHTRPRGTLLRLAGPPIPYTAPELCAPPPLPEGLPIQPALDAWALGVLLFCLLTGYFPWDRPLAEADPFYEDFLIWQASGQPRDRPQPWFGLAAAADALLRGLLDPHPRRRSAVIAIREHLGRPWRQREGEAEAVGAVEEEAGQ Predict reactive species Full Name: SH3-binding domain kinase family, member 2 Calculated Molecular Weight: 38 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: NM_001101401 Gene Symbol: SBK2 Gene ID (NCBI): 646643 RRID: AB_3670197 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P0C263 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924