Iright
BRAND / VENDOR: Proteintech

Proteintech, 32151-1-AP, CD63 Polyclonal antibody

CATALOG NUMBER: 32151-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CD63 (32151-1-AP) by Proteintech is a Polyclonal antibody targeting CD63 in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 32151-1-AP targets CD63 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A549 cells, HUVEC cells, HeLa cells, K-562 cells Positive IF/ICC detected in: NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information CD63, also known as LIMP, LAMP-3, gp55, and melanoma-associated antigen (ME491), is a member of the four-times transmembrane protein superfamily (TM4SF), which constitutes a major component of lysosomal membranes. CD63 is used as a marker for exocytosis, is involved in cellular protein sorting of late endosomes and multivesicular bodies, facilitates exosome formation, and plays a role in activating ITGB1 and integrin signaling. Furthermore, CD63 is involved in intercellular adhesion through interactions with other cell surface molecules. Specification Tested Reactivity: human, mouse Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg2110 Product name: Recombinant Mouse CD63 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 103-203 aa of NM_001042580.1 Sequence: AGYVFRDQVKSEFNKSFQQQMQNYLKDNKTATILDKLQKENNCCGASNYTDWENIPGMAKDRVPDSCCINITVGCGNDFKESTIHTQGCVETIAIWLRKNI Predict reactive species Full Name: CD63 antigen Calculated Molecular Weight: 26kDa Observed Molecular Weight: 52 kDa GenBank Accession Number: NM_001042580.1 Gene Symbol: Cd63 Gene ID (NCBI): 12512 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P41731 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924