Iright
BRAND / VENDOR: Proteintech

Proteintech, 32152-1-AP, CD79b Polyclonal antibody

CATALOG NUMBER: 32152-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CD79b (32152-1-AP) by Proteintech is a Polyclonal antibody targeting CD79b in WB, IHC, ELISA applications with reactivity to mouse samples 32152-1-AP targets CD79b in WB, IHC, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: mouse spleen tissue Positive IHC detected in: mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information CD79 molecule encompasses two transmembrane proteins, CD79a and CD79b, which form a disulfide-linked heterodimer and are members of the immunoglobulin (Ig) gene superfamily (PMID: 2033258; 1375264; 2304550). CD79b molecule (also known as B29, IGB, AGM6, and Igbeta) is expressed almost exclusively on B cells and B-cell neoplasms, influencing antigen internalization and increasing antigen presentation efficiency (PMID: 7552998). CD79b mutation could be a key biomarker for DLBCL disease progression (PMID: 36182550). Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg2113 Product name: Recombinant Mouse CD79B protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 26-158 aa of NM_008339.3 Sequence: VPAMTSSDLPLNFQGSPCSQIWQHPRFAAKKRSSMVKFHCYTNHSGALTWFRKRGSQQPQELVSEEGRIVQTQNGSVYTLTIQNIQYEDNGIYFCKQKCDSANHNVTDSCGTELLVLGFSTLDQLKRRNTLKD Predict reactive species Full Name: CD79B antigen Calculated Molecular Weight: 26 kDa Observed Molecular Weight: 35 kDa GenBank Accession Number: NM_008339.3 Gene Symbol: Cd79b Gene ID (NCBI): 15985 RRID: AB_3670210 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P15530 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924