Product Description
Size: 20ul / 150ul
The OSBPL6 (32158-1-AP) by Proteintech is a Polyclonal antibody targeting OSBPL6 in WB, IHC, ELISA applications with reactivity to human, mouse samples
32158-1-AP targets OSBPL6 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
Tested Applications
Positive WB detected in: HEL cells
Positive IHC detected in: mouse skeletal muscle tissue, mouse brain tissue, mouse lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:500-1:3000
Immunohistochemistry (IHC): IHC : 1:50-1:500
Specification
Tested Reactivity: human, mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag37534 Product name: Recombinant human OSBPL6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 189-308 aa of BC052259 Sequence: RSPRDASFHIFPSTSTAESSPAANVSVMDGKMQPNSFPWQSPLPCSNSLPATCTTGQSKVAAWLQDSEEMDRCAEDLAHCQSNLVELSKLLQNLEILQRTQSAPNFTDMQVPFSATMSPV Predict reactive species
Full Name: oxysterol binding protein-like 6
Calculated Molecular Weight: 934 aa, 106 kDa
Observed Molecular Weight: 106 kDa
GenBank Accession Number: BC052259
Gene Symbol: OSBPL6
Gene ID (NCBI): 114880
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity Purification
UNIPROT ID: Q9BZF3
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924