Iright
BRAND / VENDOR: Proteintech

Proteintech, 32175-1-AP, C1QL3 Polyclonal antibody

CATALOG NUMBER: 32175-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The C1QL3 (32175-1-AP) by Proteintech is a Polyclonal antibody targeting C1QL3 in WB, ELISA applications with reactivity to human samples 32175-1-AP targets C1QL3 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information C1Q-like (C1QL) proteins bind to the adhesion G protein coupled receptor B3 (ADGRB3) and act at synapses in a subset of circuits. Complement C1q-like 3 (C1QL3, also known as CTRP13) is one of the C1QL proteins. Some C1QL3 migrated as a monomer (~26 kDa) and some as a trimer (60-70 kDa), indicating a desired substantial yet incomplete crosslinking of monomers (PMID: 33337553). The doublet band of trimer probably represents differential posttranslational modifications (PMID: 21378161). Bands of larger molecular weights suggested either trimers cross-linked into higher molecular weight oligomers or C1QL3 cross-linked to binding partners (PMID: 33337553). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag37280 Product name: Recombinant human C1QL3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 91-140 aa of BC127716 Sequence: GEKGEPGRQGLPGPPGAPGLNAAGAISAATYSTVPKIAFYAGLKRQHEGY Predict reactive species Full Name: complement component 1, q subcomponent-like 3 Calculated Molecular Weight: 27 kDa Observed Molecular Weight: 70 kDa, 27 kDa GenBank Accession Number: BC127716 Gene Symbol: C1QL3 Gene ID (NCBI): 389941 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q5VWW1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924