Iright
BRAND / VENDOR: Proteintech

Proteintech, 32196-1-AP, CEACAM16 Polyclonal antibody

CATALOG NUMBER: 32196-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CEACAM16 (32196-1-AP) by Proteintech is a Polyclonal antibody targeting CEACAM16 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 32196-1-AP targets CEACAM16 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IHC detected in: human placenta tissue, human urothelial carcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information CEACAM16 (Carcinoembryonic Antigen-Related Cell Adhesion Molecule 16) is a member of the CEA family of cell adhesion molecules. It is a critical component of the tectorial membrane in the inner ear, playing a significant role in maintaining hearing function. Mutations in the CEACAM16 gene are associated with autosomal dominant nonsyndromic hearing loss (DFNA4B), characterized by progressive high-frequency hearing impairment. Research has shown that loss or dysfunction of CEACAM16 leads to structural abnormalities in the tectorial membrane, thereby affecting hearing. The identification of CEACAM16 has provided important insights into the genetic basis of hereditary hearing loss and has implications for the diagnosis and treatment of hearing disorders. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag37542 Product name: Recombinant human CEACAM16 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 295-425 aa of BC156855 Sequence: AKNTKTLLSGSASVVVKLSAAAVATMIVPVPTKPTEGQDVTLTVQGYPKDLLVYAWYRGPASEPNRLLSQLPSGTWIAGPAHTGREVGFPNCSLLVQKLNLTDTGRYTLKTVTVQGKTETLEVELQVAPLG Predict reactive species Full Name: carcinoembryonic antigen-related cell adhesion molecule 16 Observed Molecular Weight: 48 kDa GenBank Accession Number: BC156855 Gene Symbol: CEACAM16 Gene ID (NCBI): 388551 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q2WEN9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924