Proteintech, 32226-1-AP, ENPP7 Polyclonal antibody

Size: 20ul / 150ul The ENPP7 (32226-1-AP) by Proteintech is a Polyclonal antibody targeting ENPP7 in WB, ELISA applications with reactivity to human, mouse samples 32226-1-AP targets ENPP7 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Ectonucleotide pyrophosphatase/phosphodiesterase family member 7 (ENPP7) stands out as an alkaline sphingomyelinase that functions in the intestine to cleave sphingomyelin (SM) into ceramide and phosphocholine in a phospholipase C (PLC) -like manner and has been associated with hepatobiliary diseases. Reduced ENPP7 activity is detected in colorectal cancer and in familial adenomatous polyposis, suggesting a link between decreased SM metabolism and colon tumorigenesis (PMID: 22177013; 28292932). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36493 Product name: Recombinant human ENPP7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 150-400 aa of NM_178543.4 Sequence: QGVAVTRSRKEGIAHNYKNETEWRANIDTVMAWFTEEDLDLVTLYFGEPDSTGHRYGPESPERREMVRQVDRTVGYLRESIARNHLTDRLNLIITSDHGMTTVDKRAGDLVEFHKFPNFTFRDIEFELLDYGPNGMLLPKEGRLEKVYDALKDAHPKLHVYKKEAFPEAFHYANNPRVTPLLMYSDLGYVIHGRINVQFNNGEHGFDNKDMDMKTIFRAVGPSFRAGLEVEPFESVHVYELMCRLLGIVPE Predict reactive species Full Name: ectonucleotide pyrophosphatase/phosphodiesterase 7 Calculated Molecular Weight: 51 kDa，458aa Observed Molecular Weight: 51 kDa GenBank Accession Number: NM_178543.4 Gene Symbol: ENPP7 Gene ID (NCBI): 339221 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q6UWV6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.