Iright
BRAND / VENDOR: Proteintech

Proteintech, 32250-1-AP, CNTNAP4 Polyclonal antibody

CATALOG NUMBER: 32250-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CNTNAP4 (32250-1-AP) by Proteintech is a Polyclonal antibody targeting CNTNAP4 in WB, ELISA applications with reactivity to human samples 32250-1-AP targets CNTNAP4 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: fetal human brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Background Information Contactin-associated protein-like 4 (Cntnap4) is critical for GABAergic transmission in the brain. Impaired Cntnap4 function is implicated in neurological disorders, such as autism. Loss of Cntnap4 causes pro-inflammatory cognitive decline (PMID: 37933376). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag37716 Product name: Recombinant human CNTNAP4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1135-1241 aa of NM_033401.4 Sequence: FSAVKSLVLGRILEHSDVDQDTALAGAQGFTGCLSAVQLSHVAPLKAALHPSHPDPVTVTGHVTESSCMAQPGTDATSRERTHSFADHSGTIDDREPLANAIKSDSA Predict reactive species Full Name: contactin associated protein-like 4 Calculated Molecular Weight: 145kDa,1308aa / 137 kDa,1235aa Observed Molecular Weight: 150 kDa, 137 kDa GenBank Accession Number: NM_033401.4 Gene Symbol: CNTNAP4 Gene ID (NCBI): 85445 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9C0A0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924