Proteintech, 32265-1-AP, USP31 Polyclonal antibody

Size: 20ul / 150ul The USP31 (32265-1-AP) by Proteintech is a Polyclonal antibody targeting USP31 in WB, ELISA applications with reactivity to human samples 32265-1-AP targets USP31 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HaCaT cells, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information USP31 (Ubiquitin Specific Peptidase 31) is a protein-coding gene that encodes a thiol-dependent deubiquitinating enzyme. It is involved in the process of protein deubiquitination, which is essential for regulating protein stability, function, and degradation. USP31 is broadly expressed in various tissues, including the testis and urinary bladder. It has 2 isoforms with the molecular mass of 47 and 147 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36315 Product name: Recombinant human USP31 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1150-1352 aa of NM_020718 Sequence: SDHSLSREGSRQSLGSDRASATSTSKPNSPRVSQARAGEGRGAGKHVRSSSMASLRSPSTSIKSGLKRDSKSEDKGLSFFKSALRQKETRRSTDLGKTALLSKKAGGSSVKSVCKNTGDDEAERGHQPPASQQPNANTTGKEQLVTKDPASAKHSLLSARKSKSSQLDSGVPSSPGGRQSAEKSSKKLSSSMQTSARPSQKPQ Predict reactive species Full Name: ubiquitin specific peptidase 31 Calculated Molecular Weight: 146kDa Observed Molecular Weight: 147 kDa, 47 kDa GenBank Accession Number: NM_020718 Gene Symbol: USP31 Gene ID (NCBI): 57478 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q70CQ4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.