Iright
BRAND / VENDOR: Proteintech

Proteintech, 32267-1-AP, LINGO3 Polyclonal antibody

CATALOG NUMBER: 32267-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The LINGO3 (32267-1-AP) by Proteintech is a Polyclonal antibody targeting LINGO3 in WB, ELISA applications with reactivity to human samples 32267-1-AP targets LINGO3 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, Calu-1 cells, U-251 cells, U-87 MG cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag37289 Product name: Recombinant human LINGO3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 360-530 aa of NM_001101391 Sequence: LLWIVQRRKTLNFDGRLPACATPAEVRGDALRNLPDSVLFEYFVCRKPKIRERRLQRVTATAGEDVRFLCRAEGEPAPTVAWVTPQHRPVTATSAGRARVLPGGTLEIQDARPQDSGTYTCVASNAGGNDTYFATLTVRPEPAANRTPGEAHNETLAALRAPLDLTTILVS Predict reactive species Full Name: leucine rich repeat and Ig domain containing 3 Calculated Molecular Weight: 64kDa Observed Molecular Weight: 67 kDa GenBank Accession Number: NM_001101391 Gene Symbol: LINGO3 Gene ID (NCBI): 645191 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P0C6S8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924