Proteintech, 32273-1-AP, TMEM205 Polyclonal antibody

Size: 20ul / 150ul The TMEM205 (32273-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM205 in WB, ELISA applications with reactivity to human, rat samples 32273-1-AP targets TMEM205 in WB, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: HT-1376 cells, rat testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information As a member of the transmembrane proteins (TMEMs), TMEM205 constructed transmembrane channels for a variety of substances, mediating communication between the intracellular and extracellular environment (PMID: 38850316). Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15211 Product name: Recombinant human TMEM205 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 100-189 aa of BC064948 Sequence: TVNARWLEPRTTAAMWALQTVEKERGLGGEVPGSHQGPDPYRQLREKDPKYSALRQNFFRYHGLSSLCNLGCVLSNGLCLAGLALEIRSL Predict reactive species Full Name: transmembrane protein 205 Calculated Molecular Weight: 189 aa, 21 kDa Observed Molecular Weight: 21 kDa GenBank Accession Number: BC064948 Gene Symbol: TMEM205 Gene ID (NCBI): 374882 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q6UW68 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.