Product Description
Size: 20ul / 150ul
The ZNF706 (32274-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF706 in WB, ELISA applications with reactivity to human samples
32274-1-AP targets ZNF706 in WB, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: A431 cells, HepG2 cells, SMMC-7221 cells
Recommended dilution
Western Blot (WB): WB : 1:500-1:1000
Background Information
Zinc Finger domains account for 5% of all human proteins and interact with various substrates, such as lipids, DNA, RNA, and post-translational modifications. In addition, zinc finger proteins (ZNFs) are involved in transcriptional regulation, signal transduction, and other cellular processes. Zinc finger protein 706 (ZNF706), encoded by a gene located at chromosome 8q22.3, is a member of the C2H2-type zinc finger transcription factor family, the most abundant transcription factor family encoded by the human genome. And according to the structural analysis of ZNF706, it was definitely predicted to physically bind to DNA through the C-terminal zinc finger domain. In previous studies, it was reported that the expression of ZNF706 is upregulated in gastric cancer and laryngeal cancer. And ZNF706 may be a biomarker for the early diagnosis of rheumatoid arthritis. ZNF706 is a potential oncogene in liver cancer and functions as a ferroptosis regulator by modulating SLC7A11 expression, constituting a potential therapeutic target for HCC (PMID: 38862581).
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag37605 Product name: Recombinant human ZNF706 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-76 aa of BC015925 Sequence: MARGQQKIQSQQKNAKKQAGQKKKQGHDQKAAAKAALIYTCTVCRTQMPDPKTFKQHFESKHPKTPLPPELADVQA Predict reactive species
Full Name: zinc finger protein 706
Calculated Molecular Weight: 76 aa, 8 kDa
Observed Molecular Weight: 12 kDa
GenBank Accession Number: BC015925
Gene Symbol: ZNF706
Gene ID (NCBI): 51123
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity Purification
UNIPROT ID: Q9Y5V0
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924