Proteintech, 32283-1-AP, WBP4 Polyclonal antibody

Size: 20ul / 150ul The WBP4 (32283-1-AP) by Proteintech is a Polyclonal antibody targeting WBP4 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 32283-1-AP targets WBP4 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293T cells, HeLa cells, Jurkat cells Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U-251 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information WW domain-binding protein 4 (WBP4), formerly known as FBP21, is a 376-amino acid spliceosomal protein containing a zinc finger motif and two tandem WW domains. It is a member of the WW domain-containing protein family, which plays a role in various cellular processes including signal transduction, transcriptional regulation and protein degradation. The protein is characterised by its WW domains, which mediate interactions with proline-rich motifs in other proteins. WBP4 is involved in key signalling pathways such as Wnt and Notch and interacts with transcription factors and components of the ubiquitin-proteasome system. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35400 Product name: Recombinant human WBP4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-150 aa of BC108310 Sequence: MADYWKSQPKKFCDYCKCWIADNRPSVEFHERGKNHKENVAKRISEIKQKSLDKAKEEEKASKEFAAMEAAALKAYQEDLKRLGLESEILEPSITPVTSTIPPTSTSNQQKEKKEKKKRKKDPSKGRWVEGITSEGYHYYYDLISGASQW Predict reactive species Full Name: WW domain binding protein 4 (formin binding protein 21) Observed Molecular Weight: 50-55 kDa GenBank Accession Number: BC108310 Gene Symbol: WBP4 Gene ID (NCBI): 11193 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: O75554 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.