Iright
BRAND / VENDOR: Proteintech

Proteintech, 32285-1-AP, LRRC57 Polyclonal antibody

CATALOG NUMBER: 32285-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The LRRC57 (32285-1-AP) by Proteintech is a Polyclonal antibody targeting LRRC57 in WB, ELISA applications with reactivity to human samples 32285-1-AP targets LRRC57 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HT-29 cells, HepG2 cells, JurKat cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information Increased expression of the LRRC57 (Leucine-rich repeat containing 57) gene has been associated with bipolar disorder. The other functions of LRRC57 are not fully understood, but it plays a role in a number of cellular processes, including cell proliferation, signaling, and metabolism. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36790 Product name: Recombinant human LRRC57 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-239 aa of BC058935 Sequence: MGNSALRAHVETAQKTGVFQLKDRGLTEFPADLQKLTSNLRTIDLSNNKIESLPPLLIGKFTLLKSLSLNNNKLTVLPDEICNLKKLETLSLNNNHLRELPSTFGQLSALKTLSLSGNQLGALPPQLCSLRHLDVMDLSKNQIRSIPDSVGELQVIELNLNQNQISQISVKISCCPRLKILRLEENCLELSMLPQSILSDSQICLLAVEGNLFEIKKLRELEGYDKYMERFTATKKKFA Predict reactive species Full Name: leucine rich repeat containing 57 Observed Molecular Weight: 27 kDa GenBank Accession Number: BC058935 Gene Symbol: LRRC57 Gene ID (NCBI): 255252 RRID: AB_3670231 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q8N9N7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924