Iright
BRAND / VENDOR: Proteintech

Proteintech, 32373-1-AP, USP9Y Polyclonal antibody

CATALOG NUMBER: 32373-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The USP9Y (32373-1-AP) by Proteintech is a Polyclonal antibody targeting USP9Y in WB, ELISA applications with reactivity to human samples 32373-1-AP targets USP9Y in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information USP9Y (Ubiquitin-Specific Peptidase 9 on the Y chromosome) is a gene located in the male-specific region of the Y chromosome and is broadly expressed in male adult tissues. It encodes a functional deubiquitinating enzyme that plays a role in protein turnover (PMID: 39742627). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35809 Product name: Recombinant human USP9Y protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2361-2555 aa of NM_004654 Sequence: KGIPDDRDGLFDTIQRSKNHYQKRAYQCIKCMVALFSSCPVAYQILQGNGDLKRKWTWAVEWLGDELERRPYTGNPQYSYNNWSPPVQSNETANGYFLERSHSARMTLAKACELCPEEEPDDQDAPDEHEPSPSEDAPLYPHSPASQYQQNNHVHGQPYTGPAAHHLNNPQKTGQRTQENYEGNEEVSSPQMKDQ Predict reactive species Full Name: ubiquitin specific peptidase 9, Y-linked Calculated Molecular Weight: 291kDa Observed Molecular Weight: 250 kDa GenBank Accession Number: NM_004654 Gene Symbol: USP9Y Gene ID (NCBI): 8287 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: O00507 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924