Proteintech, 32381-1-AP, Transferrin Receptor 2/TFR2 Polyclonal antibody

Size: 20ul / 150ul The Transferrin Receptor 2/TFR2 (32381-1-AP) by Proteintech is a Polyclonal antibody targeting Transferrin Receptor 2/TFR2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 32381-1-AP targets Transferrin Receptor 2/TFR2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, rat liver tissue Positive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information Transferrin Receptor 2 (TFR2) is a type II transmembrane glycoprotein that plays a crucial role in iron homeostasis. It is highly homologous to Transferrin Receptor 1 (TFR1) and is primarily expressed in the liver and erythroid precursor cells. TFR2 is involved in the regulation of hepcidin, a hormone that controls iron absorption and distribution in the body. It helps mediate the cellular uptake of iron-bound transferrin, although its affinity for iron is lower than that of TFR1 (PMID: 24658816). It is more involved in sensing iron levels and regulating hepcidin expression rather than direct iron uptake. TFR2 is predominantly expressed in hepatocytes (liver cells) and erythroid precursors (cells that give rise to red blood cells). It is also found in the enterocytes of the small intestine (PMID: 29969719). In the liver, TFR2 acts as a sensor for circulating iron-bound transferrin and helps regulate hepcidin production. Hepcidin, in turn, controls iron absorption from the diet and iron release from macrophages. The molecular weight of TFR2 is 88 kDa, its observed molecular weight is 88-97 kDa. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag37959 Product name: Recombinant human TFR2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 105-310 aa of BC142630 Sequence: RGSCQACGDSVLVVSEDVNYEPDLDFHQGRLYWSDLQAMFLQFLGEGRLEDTIRQTSLRERVAGSAGMAALTQDIRAALSRQKLDHVWTDTHYVGLQFPDPAHPNTLHWVDEAGKVGEQLPLEDPDVYCPYSAIGNVTGELVYAHYGRPEDLQDLRARGVDPVGRLLLVRVGVISFAQKVTNAQDFGAQGVLIYPEPADFSQDPPK Predict reactive species Full Name: transferrin receptor 2 Calculated Molecular Weight: 801 aa, 89 kDa Observed Molecular Weight: 88-97 kDa GenBank Accession Number: BC142630 Gene Symbol: TFR2 Gene ID (NCBI): 7036 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9UP52 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.