Proteintech, 32392-1-AP, RBP4 Polyclonal antibody

Size: 20ul / 150ul The RBP4 (32392-1-AP) by Proteintech is a Polyclonal antibody targeting RBP4 in WB, ELISA applications with reactivity to mouse, rat samples 32392-1-AP targets RBP4 in WB, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: mouse heart tissue, mouse liver tissue, rat heart tissue, rat liver tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information RBP4 (retinol-binding protein 4) is a carrier protein that transports vitamin A (retinol) from the liver to the peripheral tissues. Synthesized primarily by hepatocytes and adipocytes as a 21 kDa non-glycosylated protein, RBP4 is secreted into the circulation as a retinol-RBP4 complex. In plasma the RBP4-retinol complex is bound to transthyretin (TRR), which prevents prevent kidney filtration. Two truncated forms of RBP4, RBP4-L (truncated at Leu-183) and RBP4-LL (truncated at Leu-182 and Leu-183), exist by proteolytic process. RBP4-L and RBP4-LL, which do not bind TTR, are normally excreted into the urine but accumulate in the serum during renal failure. Urinary RBP4 has been reported as marker for glomerular disease. RBP4 also was identified as an adipokine that elevated in some INS-resistant states. Measurement of serum RBP4 could be used to assess the risk of INS resistance, type 2 diabetes, obesity, and cardiovascular disease. (18752671, 16034410) Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg1140 Product name: Recombinant Mouse RBP4 protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 19-201 aa of NM_011255.3 Sequence: ERDCRVSSFRVKENFDKARFSGLWYAIAKKDPEGLFLQDNIIAEFSVDEKGHMSATAKGRVRLLSNWEVCADMVGTFTDTEDPAKFKMKYWGVASFLQRGNDDHWIIDTDYDTFALQYSCRLQNLDGTCADSYSFVFSRDPNGLSPETRRLVRQRQEELCLERQYRWIEHNGYCQSRPSRNSL Predict reactive species Full Name: retinol binding protein 4, plasma Calculated Molecular Weight: 23kDa Observed Molecular Weight: 17-21 kDa GenBank Accession Number: NM_011255.3 Gene Symbol: Rbp4 Gene ID (NCBI): 19662 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q00724 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.