Proteintech, 32431-1-AP, PCNX1 Polyclonal antibody

Size: 20ul / 150ul The PCNX1 (32431-1-AP) by Proteintech is a Polyclonal antibody targeting PCNX1 in WB, ELISA applications with reactivity to human samples 32431-1-AP targets PCNX1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A-253 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag37954 Product name: Recombinant human PCNX protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2035-2230 aa of BC140784 Sequence: VPCRRSSTSQISLRNLPSSIQSRLSMVNQMEPSGQSGLACVQHGLPSSSSSSQSIPACKHHTLVGFLATEGGQSSATDAQPGNTLSPANNSHSRKAEVIYRVQIVDPSQILEGINLSKRKELQWPDEGIRLKAGRNSWKDWSPQEGMEGHVIHRWVPCSRDPGTRSHIDKAVLLVQIDDKYVTVIETGVLELGAEV Predict reactive species Full Name: pecanex homolog (Drosophila) Calculated Molecular Weight: 259 kDa Observed Molecular Weight: 240 kDa GenBank Accession Number: BC140784 Gene Symbol: PCNX Gene ID (NCBI): 22990 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q96RV3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.