Proteintech, 32470-1-AP, PLXND1 Polyclonal antibody

Size: 20ul / 150ul The PLXND1 (32470-1-AP) by Proteintech is a Polyclonal antibody targeting PLXND1 in WB, ELISA applications with reactivity to human samples 32470-1-AP targets PLXND1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: JAR cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information PLXND1, also known as KIAA0620. It is predicted to be located in the cell membrane. Detected at low levels in heart, placenta, lung, skeletal muscle, kidney, thymus and liver. It is a cell surface receptor for SEMA4A and for class 3 semaphorins, such as SEMA3A, SEMA3C and SEMA3E, which plays an important role in cell-cell signaling, and in regulating the migration of a wide spectrum of cell types. Regulates the migration of thymocytes in the medulla. The protein regulates endothelial cell migration. The molecular weight of PLXND1 is 212 kDa, and the target also has phosphorylation modification as well. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag38374 Product name: Recombinant human PLXND1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1515-1700 aa of NM_015103.2 Sequence: FLLLCAIKQQINKGSIDAITGKARYTLSEEWLLRENIEAKPRNLNVSFQGCGMDSLSVRAMDTDTLTQVKEKILEAFCKNVPYSQWPRAEDVDLEWFASSTQSYILRDLDDTSVVEDGRKKLNTLAHYKIPEGASLAMSLIDKKDNTLGRVKDLDTEKYFHLVLPTDELAEPKKSHRQSHRKKVLP Predict reactive species Full Name: plexin D1 Calculated Molecular Weight: 212kDa，1925aa Observed Molecular Weight: 220-250 GenBank Accession Number: NM_015103.2 Gene Symbol: PLXND1 Gene ID (NCBI): 23129 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9Y4D7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.