Iright
BRAND / VENDOR: Proteintech

Proteintech, 32485-1-AP, EDARADD Polyclonal antibody

CATALOG NUMBER: 32485-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The EDARADD (32485-1-AP) by Proteintech is a Polyclonal antibody targeting EDARADD in WB, ELISA applications with reactivity to human samples 32485-1-AP targets EDARADD in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human placenta tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Background Information EDARADD (EDAR-associated death domain) is an adaptor protein that mediates the interaction between the extracellular Ectodysplasin A receptor (EDAR) and intracellular signaling components, orchestrating a series of downstream events that regulate key biological processes such as cell proliferation, differentiation, and apoptosis. EDARADD is a 25 KDa death domain-containing adaptor protein. EDARADD was shown to interact with TRAF1, -2 and -3 as well as with TAB2 (TAK1-binding protein 2) and is therefore likely to be responsible for coupling receptor activation with engagement of the NF-κB pathway (PMID: 23845861). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag38064 Product name: Recombinant human EDARADD protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-215 aa of BC128082 Sequence: MGLRTTKQMGRGTKAPGHQEDHMVKEPVEDTDPSTLSFNMSDKYPIQDTELPKAEECDTITLNCPRNSDMKNQGEENGFPDSTGDPLPEISKDNSCKENCTCSSCLLRAPTISDLLNDQDLLDVIRIKLDPCHPTVKNWRNFASKWGMSYDELCFLEQRPQSPTLEFLLRNSQRTVGQLMELCRLYHRADVEKVLRRWVDEEWPKRERGDPSRHF Predict reactive species Full Name: EDAR-associated death domain Observed Molecular Weight: 24 kDa GenBank Accession Number: BC128082 Gene Symbol: EDARADD Gene ID (NCBI): 128178 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q8WWZ3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924