Proteintech, 32495-1-AP, CD300a Polyclonal antibody

Size: 20ul / 150ul The CD300a (32495-1-AP) by Proteintech is a Polyclonal antibody targeting CD300a in WB, ELISA applications with reactivity to human samples 32495-1-AP targets CD300a in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: K-562 cells, THP-1 cells, U-937 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information Human CD300a is a transmembrane protein, with an immunoglobulin (Ig)V-like extracellular domain and a cytoplasmic tail containing immunoreceptor tyrosine-based inhibitory motifs (ITIMs), providing the receptor with an inhibitory capacity. The relevance of the CD300a molecule in several pathological conditions has been highlighted by multiple studies. (PMID: 37762055) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg2652 Product name: Recombinant Human CD300A protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 18-178 aa of NM_007261.4 Sequence: LSKCRTVAGPVGGSLSVQCPYEKEHRTLNKYWCRPPQIFLCDKIVETKGSAGKRNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPVVEVEVSVFPASTSMTPASITAAKTSTITTAFPPVSSTTLFAVGATHSASIQEETEEVVNSQ Predict reactive species Full Name: CD300a molecule Calculated Molecular Weight: 33 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: NM_007261.4 Gene Symbol: CD300a Gene ID (NCBI): 11314 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9UGN4-1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.