Proteintech, 32522-1-AP, PRSS21 Polyclonal antibody

Size: 20ul / 150ul The PRSS21 (32522-1-AP) by Proteintech is a Polyclonal antibody targeting PRSS21 in WB, IHC, FC (Intra), ELISA applications with reactivity to human, mouse samples 32522-1-AP targets PRSS21 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse testis tissue Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive FC (Intra) detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information PRSS21 (Serine Protease 21), a trypsin family member, may be active on peptide linkages involving the carboxyl group of lysine or arginine. In terms of disease association, PRSS21 is implicated in various cancers, such as gastric cancer, testicular cancer, and ovarian cancer. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag38156 Product name: Recombinant human PRSS21 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-314 aa of BC074999 Sequence: MGARGALLLALLLARAGLRKPESQEAAPLSGPCGRRVITSRIVGGEDAELGRWPWQGSLRLWDSHVCGVSLLSHRWALTAAHCFETYSDLSDPSGWMVQFGQLTSMPSFWSLQAYYTRYFVSNIYLSPRYLGNSPYDIALVKLSAPVTYTKHIQPICLQASTFEFENRTDCWVTGWGYIKEDEALPSPHTLQEVQVAIINNSMCNHLFLKYSFRKDIFGDMVCAGNAQGGKDACFGDSGGPLACNKNGLWYQIGVVSWGVGCGRPNRPGVYTNISHHFEWIQKLMAQSGMSQPDPSWPLLFFPLLWALPLLGPV Predict reactive species Full Name: protease, serine, 21 (testisin) Calculated Molecular Weight: 314 aa, 35 kDa GenBank Accession Number: BC074999 Gene Symbol: PRSS21 Gene ID (NCBI): 10942 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y6M0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.