Iright
BRAND / VENDOR: Proteintech

Proteintech, 32552-1-AP, KREMEN1 Polyclonal antibody

CATALOG NUMBER: 32552-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The KREMEN1 (32552-1-AP) by Proteintech is a Polyclonal antibody targeting KREMEN1 in WB, ELISA applications with reactivity to human samples 32552-1-AP targets KREMEN1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information Kremen protein 1 (KREMEN1, also known as KRM1) is a transmembrane protein that is a negative regulator of the Wnt signaling pathway (PMID: 26206087; 18502762). KREMEN1 is one of the alternative functional receptors that play essential roles in ACE2-independent virus entry, providing insight into SARS-CoV-2 tropism and pathogenesis, as well as a community resource and potential therapeutic strategies for further COVID-19 investigations (PMID: 34837059; 34903854). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag37569 Product name: Recombinant human KREMEN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 100-370 aa of BC063787 Sequence: AEHEDGVYWKYCEIPACQMPGNLGCYKDHGNPPPLTGTSKTSNKLTIQTCISFCRSQRFKFAGMESGYACFCGNNPDYWKYGEAASTECNSVCFGDHTQPCGGDGRIILFDTLVGACGGNYSAMSSVVYSPDFPDTYATGRVCYWTIRVPGASHIHFSFPLFDIRDSADMVELLDGYTHRVLARFHGRSRPPLSFNVSLDFVILYFFSDRINQAQGFAVLYQAVKEELPQERPAVNQTVAEVITEQANLSVSAARSSKVLYVITTSPSHPP Predict reactive species Full Name: kringle containing transmembrane protein 1 Calculated Molecular Weight: 473 aa, 52 kDa Observed Molecular Weight: 52 kDa GenBank Accession Number: BC063787 Gene Symbol: KREMEN1 Gene ID (NCBI): 83999 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q96MU8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924