Iright
BRAND / VENDOR: Proteintech

Proteintech, 32585-1-AP, CIB2 Polyclonal antibody

CATALOG NUMBER: 32585-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CIB2 (32585-1-AP) by Proteintech is a Polyclonal antibody targeting CIB2 in WB, ELISA applications with reactivity to human, mouse samples 32585-1-AP targets CIB2 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse heart tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information The CIB (calcium and integrin binding) protein family has 4 members (CIB1-CIB4), each composed of 4 EF-hand Ca2+-binding motifs (PMID: 27771768). CIB2 is broadly expressed in a variety of tissues, which plays a role in sensory neurons of the ear and eye involved in the regulation of Ca2+ homeostasis (PMID: 28663585; 29084757; 29255404). Mutations of CIB2 have been associated with autosomal recessive nonsyndromic deafness 48 (DFNB48), as well as syndromic deafness in Usher syndrome, type 1J (USH1J) (PMID: 23331261). The observed molecular weight of CIB2 is 39 kDa because it can form a dimer (PMID: 30174586). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag38508 Product name: Recombinant human CIB2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-187 aa of NM_006383.3 Sequence: MGNKQTIFTEEQLDNYQDCTFFNKKDILKLHSRFYELAPNLVPMDYRKSPIVHVPMSLIIQMPELRENPFKERIVAAFSEDGEGNLTFNDFVDMFSVLCESAPRELKANYAFKIYDFNTDNFICKEDLELTLARLTKSELDEEEVVLVCDKVIEEADLDGDGKLGFADFEDMIAKAPDFLSTFHIRI* Predict reactive species Full Name: calcium and integrin binding family member 2 Calculated Molecular Weight: 22 kDa,187aa Observed Molecular Weight: 39 kDa GenBank Accession Number: NM_006383.3 Gene Symbol: CIB2 Gene ID (NCBI): 10518 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: O75838 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924