Product Description
Size: 20ul / 150ul
The TAF7L (32590-1-AP) by Proteintech is a Polyclonal antibody targeting TAF7L in WB, ELISA applications with reactivity to human, mouse samples
32590-1-AP targets TAF7L in WB, ELISA applications and shows reactivity with human, mouse samples.
Tested Applications
Positive WB detected in: HeLa cells, mouse testis tissue
Recommended dilution
Western Blot (WB): WB : 1:500-1:3000
Specification
Tested Reactivity: human, mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag38542 Product name: Recombinant human TAF7L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 361-462 aa of NM_024885.3 Sequence: DCSEEYLERQLQAEFIESGQYRANEGTSSIVMEIQKQIEKKEKKLHKIQNKAQRQKDLIMKVENLTLKNHFQSVLEQLELQEKQKNEKLISLQEQLQRFLKK* Predict reactive species
Full Name: TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa
Calculated Molecular Weight: 53kDa,462aa
Observed Molecular Weight: 53 kDa
GenBank Accession Number: NM_024885.3
Gene Symbol: TAF7L
Gene ID (NCBI): 54457
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity Purification
UNIPROT ID: Q5H9L4
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924