Proteintech, 32605-1-AP, IL-1RA Polyclonal antibody

Size: 20ul / 150ul The IL-1RA (32605-1-AP) by Proteintech is a Polyclonal antibody targeting IL-1RA in WB, ELISA applications with reactivity to rat samples 32605-1-AP targets IL-1RA in WB, ELISA applications and shows reactivity with rat samples. Tested Applications Positive WB detected in: rat skin tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information Interleukin-1 Receptor Antagonist (IL-1RA) is a naturally occurring anti-inflammatory cytokine and a pivotal endogenous regulator of the pro-inflammatory interleukin-1 (IL-1) signaling pathway. The IL-1 system, primarily comprising the agonists IL-1α and IL-1β, is a central mediator of the innate immune response, inflammation, and fever. Specification Tested Reactivity: rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg3206 Product name: Recombinant Rat IL-1RA protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 27-178 aa of NM_022194.2 Sequence: HPAGKRPCKMQAFRIWDTNQKTFYLRNNQLIAGYLQGPNTKLEEKIDMVPIDFRNVFLGIHGGKLCLSCVKSGDDTKLQLEEVNITDLNKNKEEDKRFTFIRSETGPTTSFESLACPGWFLCTTLEADHPVSLTNTPKEPCTVTKFYFQEDQ Predict reactive species Full Name: interleukin 1 receptor antagonist Calculated Molecular Weight: 20 kDa Observed Molecular Weight: 18-20 kDa GenBank Accession Number: NM_022194.2 Gene Symbol: Il1rn Gene ID (NCBI): 60582 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P25086 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.