Iright
BRAND / VENDOR: Proteintech

Proteintech, 32621-1-AP, CD134/OX40 Polyclonal antibody

CATALOG NUMBER: 32621-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CD134/OX40 (32621-1-AP) by Proteintech is a Polyclonal antibody targeting CD134/OX40 in WB, IHC, ELISA applications with reactivity to mouse, rat samples 32621-1-AP targets CD134/OX40 in WB, IHC, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: Con A treated rat splenocytes, Con A treated mouse splenocytes Positive IHC detected in: mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information CD134 (OX40) is a member of the TNFR-superfamily of receptors. Predominantly expressed on activated T cells, CD134 is activated by its cognate ligand CD134L (OX40L) and functions as a T cell co-stimulatory molecule. CD134-CD134L interactions have been proposed as a potential therapeutic target for treating autoimmunity (PMID: 26215166). CD134 can interact with TRAF2, TRAF3, and TRAF5. Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg2936 Product name: Recombinant Mouse CD134/OX40 protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 20-211 aa of NM_011659.2 Sequence: VTARRLNCVKHTYPSGHKCCRECQPGHGMVSRCDHTRDTLCHPCETGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTQDTVCRCRPGTQPRQDSGYKLGVDCVPCPPGHFSPGNNQACKPWTNCTLSGKQTRHPASDSLDAVCEDRSLLATLLWETQRPTFRPTTVQSTTVWPRTSELPSPPTLVTPEGP Predict reactive species Full Name: tumor necrosis factor receptor superfamily, member 4 Calculated Molecular Weight: 30 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: NM_011659.2 Gene Symbol: CD134 Gene ID (NCBI): 22163 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P47741 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924