Iright
BRAND / VENDOR: Proteintech

Proteintech, 32673-1-AP, IFN alpha2 Polyclonal antibody

CATALOG NUMBER: 32673-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The IFN alpha2 (32673-1-AP) by Proteintech is a Polyclonal antibody targeting IFN alpha2 in WB, ELISA applications with reactivity to mouse samples 32673-1-AP targets IFN alpha2 in WB, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: Recombinant protein Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information IFN-alpha2 (Interferon-alpha 2) is a subtype of the Type I interferon family, which plays a critical role in the immune response to viral infections and certain cancers. It is a cytokine that signals through the IFNAR receptor complex (IFNAR1 and IFNAR2) to activate the JAK-STAT signaling pathway, leading to the expression of interferon-stimulated genes (ISGs). These genes have antiviral, antiproliferative, and immunomodulatory effects. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg3079 Product name: Recombinant Mouse IFN-alpha 2/IFNA2 protein (rFc Tag) (HPLC verified) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 24-190 aa of Sequence: CDLPHTYNLRNKRALKVLAQMRRLPFLSCLKDRQDFGFPLEKVDNQQIQKAQAIPVLRDLTQQTLNLFTSKASSAAWNATLLDSFCNDLHQQLNDLQTCLMQQVGVQEPPLTQEDALLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSVNLLPRLSEEKE Predict reactive species Full Name: interferon alpha 2 Calculated Molecular Weight: 22 kDa Gene Symbol: Ifna2 Gene ID (NCBI): 15965 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P01573 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924