Product Description
Size: 20ul / 150ul
The S100A8 (32681-1-AP) by Proteintech is a Polyclonal antibody targeting S100A8 in WB, IF/ICC, IP, ELISA applications with reactivity to mouse, rat samples
32681-1-AP targets S100A8 in WB, IF/ICC, IP, ELISA applications and shows reactivity with mouse, rat samples.
Tested Applications
Positive WB detected in: rat spleen tissue, mouse spleen tissue
Positive IP detected in: mouse spleen tissue
Positive IF/ICC detected in: NIH/3T3 cells
Recommended dilution
Western Blot (WB): WB : 1:2000-1:12000
Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
Background Information
S100A8 is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and as a cytokine. S100A8 may form homodimer or heterodimer with S100A9(16216873).
Specification
Tested Reactivity: mouse, rat
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Eg2959 Product name: recombinant mouse S100a8 protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 2-89 aa of NM_013650.2 Sequence: PSELEKALSNLIDVYHNYSNIQGNHHALYKNDFKKMVTTECPQFVQNINIENLFRELDINSDNAINFEEFLAMVIKVGVASHKDSHKE Predict reactive species
Full Name: S100 calcium binding protein A8 (calgranulin A)
Calculated Molecular Weight: 10 kDa
Observed Molecular Weight: 11 kDa
GenBank Accession Number: NM_013650.2
Gene Symbol: S100a8
Gene ID (NCBI): 20201
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity Purification
UNIPROT ID: P27005
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924