Proteintech, 32697-1-AP, KLHL7 Polyclonal antibody

Size: 20ul / 150ul The KLHL7 (32697-1-AP) by Proteintech is a Polyclonal antibody targeting KLHL7 in WB, ELISA applications with reactivity to human, mouse, rat samples 32697-1-AP targets KLHL7 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, mouse cerebellum tissue, mouse testis tissue, rat brain tissue, rat cerebellum tissue, HeLa cells, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information KLHL7 (Kelch-like protein 7) is a member of the Kelch-like protein family and plays significant roles in various biological processes, including cell cycle regulation, protein degradation, and cytoskeleton organization. KLHL7 is highly expressed in various cancers and is associated with malignant progression and poor prognosis. In breast cancer, high expression of KLHL7 is linked to higher histological grades, estrogen receptor (ER)-negative or human epidermal growth factor receptor 2 (HER-2)-positive tumors, and triple-negative breast cancer (TNBC), and patients with high KLHL7 expression have shorter survival times. In gastric cancer, silencing KLHL7 gene expression can inhibit the proliferation, migration, and invasion of gastric cancer cells and has shown tumor-suppressive effects in in vivo models. Moreover, KLHL7 is highly expressed in colorectal cancer and ovarian cancer, among others, and is significantly associated with low patient survival rates. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag38050 Product name: Recombinant human KLHL7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 291-586 aa of BC039585 Sequence: HDYRIALFGGSQPQSCRYFNPKDYSWTDIRCPFEKRRDAACVFWDNVVYILGGSQLFPIKRMDCYNVVKDSWYSKLGPPTPRDSLAACAAEGKIYTSGGSEVGNSALYLFECYDTRTESWHTKPSMLTQRCSHGMVEANGLIYVCGGSLGNNVSGRVLNSCEVYDPATETWTELCPMIEARKNHGLVFVKDKIFAVGGQNGLGGLDNVEYYDIKLNEWKMVSPMPWKGVTVKCAAVGSIVYVLAGFQGVGRLGHILEYNTETDKWVANSKVRAFPVTSCLICVVDTCGANEETLET Predict reactive species Full Name: kelch-like 7 (Drosophila) Calculated Molecular Weight: 586 aa, 66 kDa Observed Molecular Weight: 65 kDa GenBank Accession Number: BC039585 Gene Symbol: KLHL7 Gene ID (NCBI): 55975 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q8IXQ5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.