Proteintech, 32722-1-AP, UBXN7 Polyclonal antibody

Size: 20ul / 150ul The UBXN7 (32722-1-AP) by Proteintech is a Polyclonal antibody targeting UBXN7 in WB, ELISA applications with reactivity to human samples 32722-1-AP targets UBXN7 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: COLO 320 cells, RT-4 cells, U-251 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Background Information UBXN7(UBX domain protein 7) is a protein with ubiquitin-binding activity and ubiquitin-proteasome-binding activity. It contains four different domains, namely, the N-terminal UBA domain, the UAS domain, the Ubiquitin Interaction motif (UIM) and the C-terminal UBX domain. The level of UBXN7 will affect the metabolic state of cells. High levels of UBXN7 and HIF-1α accumulation support glycolysis, while inactivation of UBXN7 and activation of NRF2 increase oxidative phosphorylation (PMID: 33444648). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag38516 Product name: Recombinant human UBXN7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 50-200 aa of NM_015562.1 Sequence: LDGGGIAEEPSTSSASVSTVRPHTEEEVRAPIPQKQEILVEPEPLFGAPKRRRPARSIFDGFRDFQTETIRQEQELRNGGAIDKKLTTLADLFRPPIDLMHKGSFETAKECGQMQNKWLMINIQNVQDFACQCLNRDVWSNEAVKNIIREH Predict reactive species Full Name: UBX domain protein 7 Calculated Molecular Weight: 55kDa，489aa Observed Molecular Weight: 65-70 kDa GenBank Accession Number: NM_015562.1 Gene Symbol: UBXN7 Gene ID (NCBI): 26043 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: O94888 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.