Proteintech, 32734-1-AP, IL-17A Polyclonal antibody

Size: 20ul / 150ul The IL-17A (32734-1-AP) by Proteintech is a Polyclonal antibody targeting IL-17A in WB, ELISA applications with reactivity to rat samples 32734-1-AP targets IL-17A in WB, ELISA applications and shows reactivity with rat samples. Tested Applications Positive WB detected in: PMA, Ionomycin and Brefeldin A treated EL-4 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information IL17A, also named as IL-17, is a proinflammatory cytokine. IL-17, synthesized only by memory T cells and natural killer cells, has pleiotropic effects, mainly in the recruitment and activation of neutrophils. This cytokine regulates the activities of NF-kappaB and mitogen-activated protein kinases. This cytokine can stimulate the expression of IL6 and cyclooxygenase-2 (PTGS2/COX-2), as well as enhance the production of nitric oxide (NO). High levels of this cytokine are associated with several chronic inflammatory diseases including rheumatoid arthritis, psoriasis and multiple sclerosis. t IL-17A is involved in LPS-induced neuroinflammation and cognitive impairment in aged rats via microglial activation (PMID: 26373740). Western detected bands about 15 and 17 kDa for IL-17A and IL-17F (PMID: 22123224). Specification Tested Reactivity: rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg3339 Product name: Recombinant Rat IL-17A protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 18-150 aa of Sequence: AVLIPQSSVCPNAEANNFLQNVKVNLKVINSLSSKASSRRPSDYLNRSTSPWTLSRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPEKCPFTFRVEKMLVGVGCTCVSSIVRHAS Predict reactive species Full Name: similar to Interleukin-17 precursor (IL-17) (Cytotoxic T lymphocyte-associated antigen 8) (CTLA-8) Calculated Molecular Weight: 17kDa Observed Molecular Weight: 17 kDa, 15 kDa Gene Symbol: LOC301289 Gene ID (NCBI): 301289 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q61453 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.