Proteintech, 32805-1-AP, Progranulin/PGRN Polyclonal antibody

Size: 20ul / 150ul The Progranulin/PGRN (32805-1-AP) by Proteintech is a Polyclonal antibody targeting Progranulin/PGRN in WB, ELISA applications with reactivity to mouse, rat samples 32805-1-AP targets Progranulin/PGRN in WB, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: J774A.1 cells, RAW 264.7 cells, NR8383 cells, rat spleen tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information GRN, also known as PGRN or PCDGF, is a cysteine-rich protein of 68.5 kDa that is typically secreted into a highly glycosylated 88 kDa form. PGRN is a unique growth factor that plays an important role in cutaneous wound healing. It has an anti-inflammatory effect and promotes cell proliferation. When PCDGF is degraded to several 6-25 kDa fragments, called granulins (GRNs) by neutrophil proteases, a pro-inflammatory reaction occurs. PGRN is widely expressed, particularly in epithelial cells, immune cells, neurons, and chondrocytes. High levels of PGRN expression have been reported in human cancers, and its expression is closely correlated with the development and metastasis of several cancers. The recent discovery that mutations in the gene encoding for pro-granulin (GRN) cause frontotemporal lobar degeneration (FTLD), and other neurodegenerative diseases leading to dementia, has brought renewed interest in progranulin and its functions in the central nervous system. Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg3241 Product name: recombinant rat Progranulin protein Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 18-588 aa of Sequence: TQCPDGQFCPVACCLDQGGANYSCCNPLLDTWPIITSRRLDGSCQIRDHCPDGYSCLLTVSGTSSCCPFSEGVSCDDGQHCCPRGFHCSADGKSCSQISDSLLGAVQCPGSQFECPDSATCCIMIDGSWGCCPMPQASCCEDRVHCCPHGASCDLVHTRCISPTGTHPLLKKFPAQRTNRAVASFSVVCPDAKTQCPDDSTCCELPTGKYGCCPMPNAICCSDHLHCCPQDTVCDLIQSKCISKDYTTDLMTKLPGYPVNEVKCDLEVSCPDGYTCCRLNTGAWGCCPFTKAVCCEDHIHCCPAGFQCHTETGTCELGVLQVPWMKKVTASLSLPDPQILKNDVPCDDFSSCPSNNTCCRLSSGDWGCCPMPEAVCCLDHQHCCPQGFKCMDEGYCQKGDRMVAGLEKMPVRQTTLLQHGDIGCDQHTSCPVGQTCCPSLKGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARTCEKDAGSVQPSMDLTFGSKVGNVECGAGHFCHDNQSCCKDSQGGWACCPYVKGVCCRDGRHCCPIGFHCSAKGTKCLRKKTPRWDILLRDPAPRPLL Predict reactive species Full Name: granulin Calculated Molecular Weight: 63 kDa Observed Molecular Weight: 68-70 kDa Gene Symbol: Grn Gene ID (NCBI): 29143 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P23785 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.