Iright
BRAND / VENDOR: Proteintech

Proteintech, 32841-1-AP, C19orf47 Polyclonal antibody

CATALOG NUMBER: 32841-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The C19orf47 (32841-1-AP) by Proteintech is a Polyclonal antibody targeting C19orf47 in WB, ELISA applications with reactivity to human, mouse samples 32841-1-AP targets C19orf47 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, Mouse skletal muscle Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36226 Product name: Recombinant human C19orf47 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-281 aa of BC023623 Sequence: MITNSLNHDSPPSTPPRRPDTSTSKISVTVSNKMAAKSAKATAALARREEESLAVPAKRRRVTAEMEGKYVINMPKGTTPRTRKILEQQQAAKGLHRTSVFDRLGAETKADTTTGSKPTGVFSRLGATPETDEDLAWDSDNDSSSSVLQYAGVLKKLGRGPAKASPQPALTVKAKATSSATTAAAPTLRRLALSSRSGLERKPESLSKVSIIKRLGAAALVPEAQDSQVTSTKSKSSAEVKVTIKRTLVGPRGSSSSEGLGAQMDHAGTVSVFKRLGRRTF Predict reactive species Full Name: chromosome 19 open reading frame 47 Observed Molecular Weight: 45 kDa GenBank Accession Number: BC023623 Gene Symbol: C19orf47 Gene ID (NCBI): 126526 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q8N9M1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924