Proteintech, 32867-1-AP, MAGOHB Polyclonal antibody

Size: 20ul / 150ul The MAGOHB (32867-1-AP) by Proteintech is a Polyclonal antibody targeting MAGOHB in WB, ELISA applications with reactivity to human samples 32867-1-AP targets MAGOHB in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells, Raji cells, Ramos cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information Mago Homolog B, Exon Junction Complex Subunit (MAGOHB), is a key component of the exon junction complex (EJC), which is crucial for pre-mRNA splicing, mRNA transport, and nonsense-mediated decay (NMD). It plays a redundant role with MAGOH in the EJC and is required for proper mRNA processing and translation (PMID: 23917022). Additionally, MagoHB is involved in multiple biological processes, including neurogenesis, brain development, cell cycle regulation, and apoptosis (PMID: 37294214). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag37296 Product name: Recombinant human MAGOHB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-116 aa of BC010905 Sequence: MAVASDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSEITKEDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSK Predict reactive species Full Name: mago-nashi homolog B (Drosophila) Calculated Molecular Weight: 17 kDa Observed Molecular Weight: 15 kDa GenBank Accession Number: BC010905 Gene Symbol: MAGOHB Gene ID (NCBI): 55110 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q96A72 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.