Iright
BRAND / VENDOR: Proteintech

Proteintech, 32918-1-AP, C3orf22 Polyclonal antibody

CATALOG NUMBER: 32918-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The C3orf22 (32918-1-AP) by Proteintech is a Polyclonal antibody targeting C3orf22 in WB, ELISA applications with reactivity to human samples 32918-1-AP targets C3orf22 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: mouse testis tissue, rat tsetis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information C3orf22 is a gene located on chromosome 3 that encodes a protein known as Chromosome 3 Open Reading Frame 22. During embryonic development, C3orf22 is expressed in various tissues and organs, such as the brain, heart, and limbs. Its expression may be regulated by developmental stage-specific factors and signaling pathways. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag38384 Product name: Recombinant human C3orf22 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-141 aa of BC032025 Sequence: MDSSACKKSHQSKKWRIQAQENFAKKFPYRLSWLTEPDPEPLQPWEVTNDSNTVQLPLQKRLVPTRSIPVRGLGAPDFTSPSGSCPAPLPAPSPPPLCNLWELKLLSRRFPRQLAFLLSTRHTEAACPQTSKAAGLSRGLS Predict reactive species Full Name: chromosome 3 open reading frame 22 Calculated Molecular Weight: 141 aa, 16 kDa Observed Molecular Weight: 21 kDa GenBank Accession Number: BC032025 Gene Symbol: C3orf22 Gene ID (NCBI): 152065 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q8N5N4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924