Proteintech, 32922-1-AP, CFAP221 Polyclonal antibody

Size: 20ul / 150ul The CFAP221 (32922-1-AP) by Proteintech is a Polyclonal antibody targeting CFAP221 in WB, ELISA applications with reactivity to human samples 32922-1-AP targets CFAP221 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MG-63 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information CFAP221 (also known as PCDP1) is a crucial structural protein in motile cilia and sperm flagella. It is specifically located within the axillary shaft of the cilia and acts as a "connection bridge" between the adjacent outer doublet microtubules, playing a role in stabilizing the core skeleton of the axillary shaft and coordinating the sliding of microtubules. The loss of this protein's function will disrupt the structural integrity and normal oscillation of the cilia, leading to a genetic disorder known as primary ciliary dyskinesia. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag38512 Product name: Recombinant human hCG_17324 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 265-508 aa of NM_001271049.1 Sequence: LEEFERLNTLSKKVNVPPEKAMMHINFHRPPAKPKPQKVKEIEYQNLRFPVDLSNPFAVATVLNQEPGKLKIKELREVLDQGTEISKTRQMKEALFEQKVRQDIHEEMENHLKWQVHLGKDPMSFKLKKELTEEWQKACAKYKLDRGDPILDEEFQRLKTEVSHKRVVRNQEEKIKEFHPTFDPLINNTWLSRSRAQKRFQQVARKVMIQGRLFNMLSAVREMDKESILRKIGQAKQSIAQEAN Predict reactive species Full Name: primary ciliary dyskinesia protein 1 Calculated Molecular Weight: 97kDa，840a Observed Molecular Weight: 100 kDa GenBank Accession Number: NM_001271049.1 Gene Symbol: hCG_17324 Gene ID (NCBI): 200373 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q4G0U5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.