Iright
BRAND / VENDOR: Proteintech

Proteintech, 32923-1-AP, CHD1L Polyclonal antibody

CATALOG NUMBER: 32923-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CHD1L (32923-1-AP) by Proteintech is a Polyclonal antibody targeting CHD1L in WB, ELISA applications with reactivity to human samples 32923-1-AP targets CHD1L in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, HEK-293 cells, HeLa cells, HepG2 cells, MOLT-4 cells, U2OS cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information CHD1L (Chromodomain Helicase DNA Binding Protein 1-Like), also known as ALC1 (Amplified in Liver Cancer 1), encodes a multifunctional protein involved in various cellular processes such as chromatin remodeling, cell differentiation, and development. CHD1L acts as an ATP-dependent chromatin remodeling enzyme with an ATPase catalytic domain activated by double-stranded DNA. It interacts with PARP1 (poly-ADP-ribose polymerase 1) to promote chromatin relaxation at DNA damage sites, facilitating DNA repair. Overexpression of CHD1L leads to dysregulation of downstream targets in various cancers. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag38526 Product name: Recombinant human CHD1L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 704-897 aa of NM_004284.5 Sequence: SAELDYQDPDATSLKYVSGDVTHPQAGAEDALIVHCVDDSGHWGRGGLFTALEKRSAEPRKIYELAGKMKDLSLGGVLLFPVDDKESRNKGQDLLALIVAQHRDRSNVLSGIKMAALEEGLKKIFLAAKKKKASVHLPRIGHATKGFNWYGTERLIRKHLAARGIPTYIYYFPRSKSAVLHSQSSSSSSRQLVP* Predict reactive species Full Name: chromodomain helicase DNA binding protein 1-like Calculated Molecular Weight: 101kDa,897aa Observed Molecular Weight: 101 kDa GenBank Accession Number: NM_004284.5 Gene Symbol: CHD1L Gene ID (NCBI): 9557 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q86WJ1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924