Iright
BRAND / VENDOR: Proteintech

Proteintech, 32933-1-AP, C14orf73 Polyclonal antibody

CATALOG NUMBER: 32933-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The C14orf73 (32933-1-AP) by Proteintech is a Polyclonal antibody targeting C14orf73 in WB, ELISA applications with reactivity to human, mouse samples 32933-1-AP targets C14orf73 in applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A549 cells, U-251 cells, mouse liver tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Background Information C14orf73 (chromosome 14 open reading frame 73), also known as EXOC3L4 or SEC6-like protein C14orf73, is a protein composed of 722 amino acids and belongs to the SEC6 family. This protein is a component of the exocyst complex, which plays an important role in the cellular secretion process, participating in vesicle targeting and fusion. The C14orf73 protein is predicted to have SNARE binding activity, involved in the localization of the exocyst complex and exocytosis. Additionally, rare variants in the splicing regulatory elements of this gene are associated with Alzheimer's disease. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35995 Product name: Recombinant human C14orf73 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-255 aa of BC113655 Sequence: MPSPQTDTPGPELQSPKEAEEPQTPAQGSRRTSSRKEPNAHRKDGTRLGLGSLRQAFSRASQRALTQVSKEDTGLFWRSSCSLFRSFRQALNEGPATGHSQATPEVPSGVMNGVSQQASTGAASEELKPEAEGKSVADLITERQLLAAFEQLLRLETLLVAEKASRTFEQDPTAFARRAMDVCLHYDGLAAEIGAIVRETLDSDGVDAAALAELARVVSAEEEAHPSPPDDGDFLRTPRRWRQHWEEAVRRSAQE Predict reactive species Full Name: chromosome 14 open reading frame 73 Observed Molecular Weight: 80 kDa GenBank Accession Number: BC113655 Gene Symbol: C14orf73 Gene ID (NCBI): 91828 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q17RC7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924