Proteintech, 33002-1-AP, SLPI Polyclonal antibody

Size: 20ul / 150ul The SLPI (33002-1-AP) by Proteintech is a Polyclonal antibody targeting SLPI in WB, IP, ELISA applications with reactivity to mouse samples 33002-1-AP targets SLPI in WB, IP, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: mouse colon tissue, mouse lung tissue Positive IP detected in: mouse lung tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information Secretory leukocyte protease inhibitor (SLPI) is also named as Antileukoproteinase (ALP), BLPI, HUSI-1, WAP4, WFDC4 and mucus proteinase inhibitor (MPI). The SLPI is a multifunctional protein involved in the modulation of immunological response and the inhibition of protease activities. SLPI acts as an inhibitor of proteases, exerts antibacterial properties, and suppresses the transcription of proinflammatory genes through the nuclear factor-kappa B (NF-κB) pathway (PMID: 37356220). SLPI is as a serine protease inhibitor and also as a critical mediator that is involved in the PTH-mediated shift to the osteoblastic phase (PMID: 17474882). Slpi induction in osteoblasts enhances its differentiation, and increases osteoblast-osteoclast contact, thereby suppressing osteoclastic function (PMID: 17474882). SLPI is an evolutionarily conserved, pleiotropic protein expressed at mucosal surfaces, mainly by epithelial cells (PMID: 33602652). SLPI maintains homeostasis at barrier tissues by preventing tissue destruction and regulating the threshold of inflammatory immune responses, while protecting the host from infection. However, as recent studies demonstrate that overexpression of SLPI increases the metastatic potential of epithelial tumors (PMID: 33602652). The role of this protein as a regulatory agent has been implicated in various types of cancer (PMID: 37356220). Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg2905 Product name: recombinant mouse Slpi protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 26-131 aa of NM_011414.3 Sequence: GKNDAIKIGACPAKKPAQCLKLEKPQCRTDWECPGKQRCCQDACGSKCVNPVPIRKPVWRKPGRCVKTQARCMMLNPPNVCQRDGQCDGKYKCCEGICGKVCLPPM Predict reactive species Full Name: secretory leukocyte peptidase inhibitor Calculated Molecular Weight: 14 kDa Observed Molecular Weight: 14 kDa GenBank Accession Number: NM_011414.3 Gene Symbol: Slpi Gene ID (NCBI): 20568 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P97430 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.