Iright
BRAND / VENDOR: Proteintech

Proteintech, 33030-1-AP, CHTF8 Polyclonal antibody

CATALOG NUMBER: 33030-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CHTF8 (33030-1-AP) by Proteintech is a Polyclonal antibody targeting CHTF8 in WB, ELISA applications with reactivity to human samples 33030-1-AP targets CHTF8 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-7 cells, MDA-MB-231 cells, MKN-45 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information CHTF8 (C-terminal binding protein Transcriptional co-Factor 8) is a crucial protein that serves as a core component of the chromatin assembly factor-1 (CAF-1) complex. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag39083 Product name: Recombinant human CHTF8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-121 aa of BC018700 Sequence: MVQIVISSARAGGLAEWVLMELQGEIEARYSTGLAGNLLGDLHYTTEGIPVLIVGHHILYGKIIHLEKPFAVLVKHTPGDQDCDELGRETGTRYLVTALIKDKILFKTRPKPIITSVPKKV Predict reactive species Full Name: CTF8, chromosome transmission fidelity factor 8 homolog (S. cerevisiae) Observed Molecular Weight: 15 kDa GenBank Accession Number: BC018700 Gene Symbol: CHTF8 Gene ID (NCBI): 54921 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P0CG13 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924