Iright
BRAND / VENDOR: Proteintech

Proteintech, 33050-1-AP, BBIP1 Polyclonal antibody

CATALOG NUMBER: 33050-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The BBIP1 (33050-1-AP) by Proteintech is a Polyclonal antibody targeting BBIP1 in WB, ELISA applications with reactivity to human samples 33050-1-AP targets BBIP1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, PANC-1 cells, U-87 MG cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information The BBIP1 protein is a key component of the BBSome complex and was identified due to its role in the pathogenesis of Bardet-Biedl syndrome (BBS). This protein localizes to the base of cellular cilia and plays an indispensable role in ciliary assembly, maintenance, and signal transduction. As an adapter for membrane protein trafficking, BBIP1 works in coordination with other members of the BBSome to precisely transport specific cargo proteins into the cilium, an important cellular organelle. Loss of its function disrupts the stability of the BBSome complex, leading to abnormalities in ciliary structure and function. This, in turn, causes various clinical symptoms of BBS, including retinal degeneration, obesity, and polydactyly. Therefore, research on BBIP1 is central to understanding the molecular basis of cilia-related diseases (ciliopathies). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36924 Product name: Recombinant human BBIP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-92 aa of BC015550 Sequence: MLKAAAKRPELSGKNTISNNSDMAEVKSMFREVLPKQGPLFVEDIMTMVLCKPKLLPLKSLTLEKLEKMHQAAQNTIRQQEMAEKDQRQITH* Predict reactive species Full Name: non-protein coding RNA 81 Observed Molecular Weight: 22 kDa GenBank Accession Number: BC015550 Gene Symbol: NCRNA00081 Gene ID (NCBI): 92482 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: A8MTZ0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924