Proteintech, 33056-1-AP, TRMT10B Polyclonal antibody

Size: 20ul / 150ul The TRMT10B (33056-1-AP) by Proteintech is a Polyclonal antibody targeting TRMT10B in WB, ELISA applications with reactivity to human samples 33056-1-AP targets TRMT10B in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HAP1 cells, HL-60 cells, HeLa cells, Raji cells, SH-SY5Y cells, SK-N-SH cells, THP-1 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information The TRM10 family of methyltransferases is responsible for the N1-methylation of purines at position 9 of tRNAs in Archaea and Eukarya. The human genome encodes three TRM10-type enzymes. TRMT10B is the first m1A9-specific tRNA methyltransferase found in eukaryotes and is responsible for the modification of a single nuclear-encoded tRNA. Furthermore, we show that the lack of G9 methylation causes a decrease in the steady-state levels of the initiator tRNAiMet-CAT and an alteration in its further post-transcriptional modification (PMID: 32392304). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36835 Product name: Recombinant human RG9MTD3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-140 aa of BC012175 Sequence: MDWKLEGSTQKVESPVLQGQEGILEETGEDGLPEGFQLLQIDAEGECQEGEILATGSTAWCSKNVQRKQRHWEKIVAAKKSKRKQEKERRKANRAENPGICPQHSKRFLRALTKDKLLEAKHSGPRLCIDLSMTHYMSKK Predict reactive species Full Name: RNA (guanine-9-) methyltransferase domain containing 3 Calculated Molecular Weight: 36 kDa Observed Molecular Weight: 40 kDa GenBank Accession Number: BC012175 Gene Symbol: RG9MTD3 Gene ID (NCBI): 158234 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q6PF06 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.